Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S12 [50302] (2 species) |
Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries) Uniprot P17293 |
Domain d2hgro1: 2hgr O:5-122 [136452] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1 automatically matched to d1i94l_ protein/RNA complex |
PDB Entry: 2hgr (more details), 4.51 Å
SCOPe Domain Sequences for d2hgro1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgro1 b.40.4.5 (O:5-122) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygt
Timeline for d2hgro1: