Lineage for d2hgrk1 (2hgr K:1-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219328Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1219329Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1219330Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1219331Protein Ribosomal protein S8 [56049] (4 species)
  7. 1219349Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1219390Domain d2hgrk1: 2hgr K:1-138 [136449]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1
    automatically matched to d1fjgh_
    protein/RNA complex

Details for d2hgrk1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (K:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2hgrk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrk1 d.140.1.1 (K:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2hgrk1:

Click to download the PDB-style file with coordinates for d2hgrk1.
(The format of our PDB-style files is described here.)

Timeline for d2hgrk1: