Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
Domain d2hgpt1: 2hgp T:2-105 [136436] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hgp (more details), 5.5 Å
SCOPe Domain Sequences for d2hgpt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgpt1 b.40.4.5 (T:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d2hgpt1: