Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (1 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) |
Domain d2hgps1: 2hgp S:1-83 [136435] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1 automatically matched to d1emwa_ |
PDB Entry: 2hgp (more details), 5.5 Å
SCOP Domain Sequences for d2hgps1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgps1 d.27.1.1 (S:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2hgps1: