Lineage for d2hgpr1 (2hgp R:2-89)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725434Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1725435Protein Ribosomal protein S15 [47065] (3 species)
  7. 1725449Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1725483Domain d2hgpr1: 2hgp R:2-89 [136434]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1

Details for d2hgpr1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (R:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2hgpr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpr1 a.16.1.2 (R:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2hgpr1:

Click to download the PDB-style file with coordinates for d2hgpr1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpr1: