![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
![]() | Domain d2hgpp1: 2hgp P:2-126 [136432] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 |
PDB Entry: 2hgp (more details), 5.5 Å
SCOPe Domain Sequences for d2hgpp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgpp1 a.156.1.1 (P:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2hgpp1: