![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
![]() | Domain d2hgpg1: 2hgp G:2-209 [136423] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 |
PDB Entry: 2hgp (more details), 5.5 Å
SCOPe Domain Sequences for d2hgpg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgpg1 d.66.1.2 (G:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d2hgpg1: