SCOPe 2.01: Domain d2hgiq1: 2hgi Q:2-61

Lineage for d2hgiq1 (2hgi Q:2-61)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2hgiq1: 2hgi Q:2-61 [136412]
   Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1
   automatically matched to d1fjgn_

Details for d2hgiq1

PDB Entry: 2hgi, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.

PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2hgiq1:

Sequence; same for both SEQRES and ATOM records:

>d2hgiq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2hgiq1:

• d2hgiq1 first appeared in SCOP 1.73
  
• d2hgiq1 appears in SCOP 1.75
  
• d2hgiq1 appears in SCOPe 2.02
  
• d2hgiq1 appears in the current release, SCOPe 2.08