Lineage for d2hgip1 (2hgi P:2-126)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779266Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 779267Protein Ribosomal protein S13 [46948] (2 species)
  7. 779295Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 779332Domain d2hgip1: 2hgi P:2-126 [136411]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1
    automatically matched to d1fjgm_

Details for d2hgip1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (P:) 30S ribosomal protein S13

SCOP Domain Sequences for d2hgip1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgip1 a.156.1.1 (P:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d2hgip1:

Click to download the PDB-style file with coordinates for d2hgip1.
(The format of our PDB-style files is described here.)

Timeline for d2hgip1: