Lineage for d2hgim1 (2hgi M:3-100)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862993Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 862994Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 862995Protein Ribosomal protein S10 [55001] (2 species)
  7. 863021Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 863060Domain d2hgim1: 2hgi M:3-100 [136408]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1
    automatically matched to d1fjgj_

Details for d2hgim1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (M:) 30S ribosomal protein S10

SCOP Domain Sequences for d2hgim1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgim1 d.58.15.1 (M:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d2hgim1:

Click to download the PDB-style file with coordinates for d2hgim1.
(The format of our PDB-style files is described here.)

Timeline for d2hgim1: