Lineage for d2hgif2 (2hgi F:107-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554405Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2554406Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2554407Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2554408Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2554434Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2554464Domain d2hgif2: 2hgi F:107-207 [136401]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1

Details for d2hgif2

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (F:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2hgif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgif2 d.53.1.1 (F:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d2hgif2:

Click to download the PDB-style file with coordinates for d2hgif2.
(The format of our PDB-style files is described here.)

Timeline for d2hgif2: