Lineage for d2hg3m_ (2hg3 M:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579961Protein automated matches [190224] (9 species)
    not a true protein
  7. 2579980Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)
  8. 2580015Domain d2hg3m_: 2hg3 M: [136392]
    Other proteins in same PDB: d2hg3h1, d2hg3h2
    automated match to d1ystm_
    complexed with bcl, bph, cdl, fe, gol, hto, k, lda, pc9, po4, u10

Details for d2hg3m_

PDB Entry: 2hg3 (more details), 2.7 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with brominated phosphatidylcholine
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2hg3m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg3m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d2hg3m_:

Click to download the PDB-style file with coordinates for d2hg3m_.
(The format of our PDB-style files is described here.)

Timeline for d2hg3m_: