SCOPe 2.05: Domain d2hffh1: 2hff H:1-113

Lineage for d2hffh1 (2hff H:1-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d2hffh1: 2hff H:1-113 [136381]
   Other proteins in same PDB: d2hffa1, d2hffa2, d2hffb2, d2hffh2, d2hffl1, d2hffl2
   automatically matched to d1mf2h1

Details for d2hffh1

PDB Entry: 2hff, 1.95 Å

PDB Description: Crystal structure of CB2 Fab

PDB Compounds: (H:) CB2 Fab, heavy chain

SCOPe Domain Sequences for d2hffh1:

Sequence, based on SEQRES records:

>d2hffh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
vtvss

Sequence, based on observed residues (ATOM records):

>d2hffh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
adsvkgrftisadtskntaylqmnslraedtavyycarrvcaggmdywgqgtlvtvss

Timeline for d2hffh1:

• d2hffh1 first appeared in SCOP 1.73
  
• d2hffh1 appears in SCOPe 2.04
  
• d2hffh1 appears in SCOPe 2.06
  
• d2hffh1 appears in the current release, SCOPe 2.08