SCOPe 2.06: Domain d2hfda1: 2hfd A:1-132

Lineage for d2hfda1 (2hfd A:1-132)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.20: HyaE-like [142401] (2 proteins)
   Pfam PF07449; have evolved a different function; contains no conserved cysteine residues

6. Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)

7. Species Escherichia coli [TaxId:562] [142403] (1 PDB entry)
   Uniprot P19931 1-132

8. Domain d2hfda1: 2hfd A:1-132 [136377]

Details for d2hfda1

PDB Entry: 2hfd

PDB Description: nmr structure of protein hydrogenase-1 operon protein hyae from escherichia coli: northeast structural genomics consortium target er415

PDB Compounds: (A:) Hydrogenase-1 operon protein hyaE

SCOPe Domain Sequences for d2hfda1:

Sequence; same for both SEQRES and ATOM records:

>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]}
msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
rglvepqqeras

Timeline for d2hfda1:

• d2hfda1 first appeared in SCOP 1.73
  
• d2hfda1 appears in SCOPe 2.05
  
• d2hfda1 appears in SCOPe 2.07
  
• d2hfda1 appears in the current release, SCOPe 2.08