SCOP 1.73: Domain d2hetd1: 2het D:9-190

Lineage for d2hetd1 (2het D:9-190)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Recoverin [47533] (1 species)
   Calcium-myristoyl switch; only one EF-hand is functional

7. Species Cow (Bos taurus) [TaxId:9913] [47534] (8 PDB entries)

8. Domain d2hetd1: 2het D:9-190 [136359]
   automatically matched to d1omra_
   complexed with ca

Details for d2hetd1

PDB Entry: 2het, 3 Å

PDB Description: Non-myristoylated bovine recoverin (truncated at C-terminus) with calcium bound to EF-hand 3

PDB Compounds: (D:) Recoverin

SCOP Domain Sequences for d2hetd1:

Sequence; same for both SEQRES and ATOM records:

>d2hetd1 a.39.1.5 (D:9-190) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
ep

Timeline for d2hetd1:

• d2hetd1 is new in SCOP 1.73
  
• d2hetd1 appears in SCOP 1.75
  
• d2hetd1 appears in the current release, SCOPe 2.08, called d2hetd_