SCOPe 2.07: Domain d2hekb_: 2hek B:

Lineage for d2hekb_ (2hek B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein automated matches [190349] (3 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187322] (1 PDB entry)

8. Domain d2hekb_: 2hek B: [136355]
   Other proteins in same PDB: d2heka1
   automated match to d2heka1
   complexed with br, cl, gdp, gol, po4, zn

Details for d2hekb_

PDB Entry: 2hek, 2 Å

PDB Description: crystal structure of o67745, a hypothetical protein from aquifex aeolicus at 2.0 a resolution.

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2hekb_:

Sequence; same for both SEQRES and ATOM records:

>d2hekb_ a.211.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh
itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye
ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff
dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl
isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke
rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql
wekarselk

Timeline for d2hekb_:

• d2hekb_ first appeared in SCOP 1.73, called d2hekb1
  
• d2hekb_ appears in SCOPe 2.06
  
• d2hekb_ appears in the current release, SCOPe 2.08