SCOP 1.73: Domain d2heka1: 2hek A:1-369

Lineage for d2heka1 (2hek A:1-369)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.1: HD domain [101340] (6 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Hypothetical protein aq_1910 [140765] (1 species)
   elaborated with additional structures in C-terminal extension

7. Species Aquifex aeolicus [TaxId:63363] [140766] (1 PDB entry)

8. Domain d2heka1: 2hek A:1-369 [136354]
   complexed with br, cl, gdp, gol, po4, zn

Details for d2heka1

PDB Entry: 2hek, 2 Å

PDB Description: crystal structure of o67745, a hypothetical protein from aquifex aeolicus at 2.0 a resolution.

PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2heka1:

Sequence; same for both SEQRES and ATOM records:

>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]}
mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh
itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye
ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff
dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl
isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke
rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql
wekarselk

Timeline for d2heka1:

• d2heka1 is new in SCOP 1.73
  
• d2heka1 appears in SCOP 1.75
  
• d2heka1 appears in the current release, SCOPe 2.08