SCOP 1.73: Domain d2hdsa1: 2hds A:4-361

Lineage for d2hdsa1 (2hds A:4-361)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries)

8. Domain d2hdsa1: 2hds A:4-361 [136350]
   automatically matched to d1c3ba_
   complexed with 4mb, na, po4, suc

Details for d2hdsa1

PDB Entry: 2hds, 1.16 Å

PDB Description: ampc beta-lactamase in complex with 4-methanesulfonylamino benzoic acid

PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d2hdsa1:

Sequence; same for both SEQRES and ATOM records:

>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d2hdsa1:

• d2hdsa1 is new in SCOP 1.73
  
• d2hdsa1 appears in SCOP 1.75
  
• d2hdsa1 appears in the current release, SCOPe 2.08, called d2hdsa_