Lineage for d2hd1b_ (2hd1 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 928039Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)
  7. 928040Species Human (Homo sapiens) [TaxId:9606] [109943] (11 PDB entries)
    Uniprot O76083 241-566
  8. 928050Domain d2hd1b_: 2hd1 B: [136339]
    automated match to d1tbma_
    complexed with ibm, mg, zn

Details for d2hd1b_

PDB Entry: 2hd1 (more details), 2.23 Å

PDB Description: Crystal structure of PDE9 in complex with IBMX
PDB Compounds: (B:) Phosphodiesterase 9A

SCOPe Domain Sequences for d2hd1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hd1b_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

SCOPe Domain Coordinates for d2hd1b_:

Click to download the PDB-style file with coordinates for d2hd1b_.
(The format of our PDB-style files is described here.)

Timeline for d2hd1b_: