SCOP 1.73: Domain d2hbba1: 2hbb A:1-51

Lineage for d2hbba1 (2hbb A:1-51)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.100: L9 N-domain-like [55657] (1 superfamily)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (7 PDB entries)

8. Domain d2hbba1: 2hbb A:1-51 [136310]
   automatically matched to d1cqua_
   complexed with zn

Details for d2hbba1

PDB Entry: 2hbb, 1.9 Å

PDB Description: crystal structure of the n-terminal domain of ribosomal protein l9 (ntl9)

PDB Compounds: (A:) 50S ribosomal protein L9

SCOP Domain Sequences for d2hbba1:

Sequence; same for both SEQRES and ATOM records:

>d2hbba1 d.100.1.1 (A:1-51) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqk

Timeline for d2hbba1:

• d2hbba1 is new in SCOP 1.73
  
• d2hbba1 appears in SCOP 1.75
  
• d2hbba1 appears in the current release, SCOPe 2.08