SCOP 1.73: Domain d2h9dc1: 2h9d C:1-94

Lineage for d2h9dc1 (2h9d C:1-94)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Salicylate biosynthesis protein PchB [140938] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)

8. Domain d2h9dc1: 2h9d C:1-94 [136252]
   automatically matched to 2H9D A:1-94
   complexed with ca, pyr

Details for d2h9dc1

PDB Entry: 2h9d, 1.95 Å

PDB Description: pyruvate-bound structure of the isochorismate-pyruvate lyase from pseudomonas aerugionsa

PDB Compounds: (C:) Salicylate biosynthesis protein pchB

SCOP Domain Sequences for d2h9dc1:

Sequence; same for both SEQRES and ATOM records:

>d2h9dc1 a.130.1.1 (C:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikyw

Timeline for d2h9dc1:

• d2h9dc1 is new in SCOP 1.73
  
• d2h9dc1 appears in SCOP 1.75
  
• d2h9dc1 appears in the current release, SCOPe 2.08, called d2h9dc_