Class a: All alpha proteins [46456] (258 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (4 families) |
Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins) intertwined homodimer of 3-helical subunits |
Protein Salicylate biosynthesis protein PchB [140938] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries) |
Domain d2h9dc1: 2h9d C:1-94 [136252] automatically matched to 2H9D A:1-94 complexed with ca, pyr |
PDB Entry: 2h9d (more details), 1.95 Å
SCOP Domain Sequences for d2h9dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9dc1 a.130.1.1 (C:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]} mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe rarwaeengldapfveglfaqiihwyiaeqikyw
Timeline for d2h9dc1: