| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (19 species) |
| Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (6 PDB entries) |
| Domain d2h8fc1: 2h8f C:1-142 [136241] Other proteins in same PDB: d2h8fb1, d2h8fd1 automatically matched to d1hbha_ complexed with ace, hem |
PDB Entry: 2h8f (more details), 1.3 Å
SCOP Domain Sequences for d2h8fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8fc1 a.1.1.2 (C:1-142) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr
Timeline for d2h8fc1: