SCOPe 2.07: Domain d2h8dc_: 2h8d C:

Lineage for d2h8dc_ (2h8d C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)

8. Domain d2h8dc_: 2h8d C: [136237]
   Other proteins in same PDB: d2h8db_, d2h8dd_
   automated match to d1hbha_
   complexed with hem, k

Details for d2h8dc_

PDB Entry: 2h8d, 1.78 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 8.4

PDB Compounds: (C:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d2h8dc_:

Sequence; same for both SEQRES and ATOM records:

>d2h8dc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d2h8dc_:

• d2h8dc_ first appeared in SCOP 1.73, called d2h8dc1
  
• d2h8dc_ appears in SCOPe 2.06
  
• d2h8dc_ appears in the current release, SCOPe 2.08