Lineage for d2h8dc1 (2h8d C:1-142)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758592Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (7 PDB entries)
  8. 758597Domain d2h8dc1: 2h8d C:1-142 [136237]
    Other proteins in same PDB: d2h8db1, d2h8dd1
    automatically matched to d1hbha_
    complexed with ace, hem, k

Details for d2h8dc1

PDB Entry: 2h8d (more details), 1.78 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 8.4
PDB Compounds: (C:) Hemoglobin alpha subunit

SCOP Domain Sequences for d2h8dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8dc1 a.1.1.2 (C:1-142) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d2h8dc1:

Click to download the PDB-style file with coordinates for d2h8dc1.
(The format of our PDB-style files is described here.)

Timeline for d2h8dc1: