SCOP 1.73: Domain d2h8dc1: 2h8d C:1-142

Lineage for d2h8dc1 (2h8d C:1-142)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (6 PDB entries)

8. Domain d2h8dc1: 2h8d C:1-142 [136237]
   Other proteins in same PDB: d2h8db1, d2h8dd1
   automatically matched to d1hbha_
   complexed with ace, hem, k

Details for d2h8dc1

PDB Entry: 2h8d, 1.78 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 8.4

PDB Compounds: (C:) Hemoglobin alpha subunit

SCOP Domain Sequences for d2h8dc1:

Sequence; same for both SEQRES and ATOM records:

>d2h8dc1 a.1.1.2 (C:1-142) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d2h8dc1:

• d2h8dc1 is new in SCOP 1.73
  
• d2h8dc1 appears in SCOP 1.75
  
• d2h8dc1 appears in the current release, SCOPe 2.08, called d2h8dc_