Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (1 family) |
Family a.104.1.1: Cytochrome P450 [48265] (22 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (60 PDB entries) Uniprot P00183 |
Domain d2h7qa1: 2h7q A:10-414 [136222] automatically matched to d1p2ya_ complexed with hem, imd |
PDB Entry: 2h7q (more details), 1.5 Å
SCOP Domain Sequences for d2h7qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h7qa1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d2h7qa1: