| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries) |
| Domain d2h6pa2: 2h6p A:1-181 [136202] Other proteins in same PDB: d2h6pa1, d2h6pb_ automatically matched to d1a1ma2 |
PDB Entry: 2h6p (more details), 1.9 Å
SCOPe Domain Sequences for d2h6pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h6pa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d2h6pa2: