Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
Domain d2h6pa1: 2h6p A:182-276 [136201] Other proteins in same PDB: d2h6pa2, d2h6pb1 automatically matched to d1a1ma1 |
PDB Entry: 2h6p (more details), 1.9 Å
SCOP Domain Sequences for d2h6pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h6pa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d2h6pa1: