SCOPe 2.04: Domain d2h64c_: 2h64 C:

Lineage for d2h64c_ (2h64 C:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (2 PDB entries)
   Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154)

8. Domain d2h64c_: 2h64 C: [136182]
   Other proteins in same PDB: d2h64a1, d2h64b_
   automated match to d1nysa_

Details for d2h64c_

PDB Entry: 2h64, 1.92 Å

PDB Description: crystal structure of a ternary ligand-receptor complex of bmp-2

PDB Compounds: (C:) Acvr2b protein

SCOPe Domain Sequences for d2h64c_:

Sequence; same for both SEQRES and ATOM records:

>d2h64c_ g.7.1.3 (C:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]}
aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
cydrqecvateenpqvyfcccegnfcnerfthlp

Timeline for d2h64c_:

• d2h64c_ first appeared in SCOP 1.73, called d2h64c1
  
• d2h64c_ appears in SCOPe 2.03
  
• d2h64c_ appears in SCOPe 2.05
  
• d2h64c_ appears in the current release, SCOPe 2.08