Lineage for d2h62c1 (2h62 C:34-117)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748275Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 748276Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 748462Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 748463Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 748464Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)
  8. 748465Domain d2h62c1: 2h62 C:34-117 [136179]
    Other proteins in same PDB: d2h62a1, d2h62b1, d2h62d1
    automatically matched to d1es7d_

Details for d2h62c1

PDB Entry: 2h62 (more details), 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2
PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOP Domain Sequences for d2h62c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlpp

SCOP Domain Coordinates for d2h62c1:

Click to download the PDB-style file with coordinates for d2h62c1.
(The format of our PDB-style files is described here.)

Timeline for d2h62c1: