Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (1 protein) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (4 PDB entries) |
Domain d2h61g1: 2h61 G:1-90 [136175] automatically matched to d1mq1a_ complexed with ca, pg4 |
PDB Entry: 2h61 (more details), 1.9 Å
SCOP Domain Sequences for d2h61g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h61g1 a.39.1.2 (G:1-90) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]} selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl dndgdgecdfqefmafvamvttacheffeh
Timeline for d2h61g1: