Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) |
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
Protein automated matches [190196] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186938] (9 PDB entries) |
Domain d2h52b_: 2h52 B: [136115] automated match to d1t8pa_ complexed with 3pg, hai |
PDB Entry: 2h52 (more details), 2 Å
SCOPe Domain Sequences for d2h52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h52b_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai qaaikkvedqgkv
Timeline for d2h52b_: