Lineage for d2h4za1 (2h4z A:3-250)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703820Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 703821Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 703822Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)
  6. 703833Protein Phosphoglycerate mutase [53256] (6 species)
  7. 703864Species Human (Homo sapiens) [TaxId:9606] [110656] (7 PDB entries)
  8. 703873Domain d2h4za1: 2h4z A:3-250 [136088]
    automatically matched to d1t8pa_
    complexed with dg2

Details for d2h4za1

PDB Entry: 2h4z (more details), 2 Å

PDB Description: human bisphosphoglycerate mutase complexed with 2,3- bisphosphoglycerate
PDB Compounds: (A:) Bisphosphoglycerate mutase

SCOP Domain Sequences for d2h4za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4za1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]}
kyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvlnr
sihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynvt
pppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgkt
ilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeaiq
aaikkved

SCOP Domain Coordinates for d2h4za1:

Click to download the PDB-style file with coordinates for d2h4za1.
(The format of our PDB-style files is described here.)

Timeline for d2h4za1: