Lineage for d2h43a1 (2h43 A:126-195)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895303Protein Fibrinogen alpha chain [88887] (4 species)
  7. 895312Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 895342Domain d2h43a1: 2h43 A:126-195 [136067]

Details for d2h43a1

PDB Entry: 2h43 (more details), 2.7 Å

PDB Description: crystal structure of human fragment d complexed with ala-his-arg-pro- amide
PDB Compounds: (A:) fibrinogen alpha chain

SCOP Domain Sequences for d2h43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h43a1 h.1.8.1 (A:126-195) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakdllp

SCOP Domain Coordinates for d2h43a1:

Click to download the PDB-style file with coordinates for d2h43a1.
(The format of our PDB-style files is described here.)

Timeline for d2h43a1: