Lineage for d2h3eb2 (2h3e B:101-153)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893271Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 893272Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 893273Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 893277Species Escherichia coli [TaxId:562] [57828] (46 PDB entries)
    Uniprot P00478
  8. 893282Domain d2h3eb2: 2h3e B:101-153 [136039]
    Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb1, d2h3ec1, d2h3ec2, d2h3ed1
    automatically matched to d1acmb2
    complexed with 6pr, zn

Details for d2h3eb2

PDB Entry: 2h3e (more details), 2.3 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2h3eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3eb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d2h3eb2:

Click to download the PDB-style file with coordinates for d2h3eb2.
(The format of our PDB-style files is described here.)

Timeline for d2h3eb2: