Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d2h2sd2: 2h2s D:107-211 [136025] Other proteins in same PDB: d2h2sa_, d2h2sb_, d2h2sd1, d2h2sf1 automated match to d1ikfl2 complexed with sek; mutant |
PDB Entry: 2h2s (more details), 3.1 Å
SCOPe Domain Sequences for d2h2sd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2sd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d2h2sd2:
View in 3D Domains from other chains: (mouse over for more information) d2h2sa_, d2h2sb_, d2h2sf1, d2h2sf2 |