Lineage for d2h2sd2 (2h2s D:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656508Domain d2h2sd2: 2h2s D:107-210 [136025]
    Other proteins in same PDB: d2h2sa1, d2h2sb1, d2h2sd1, d2h2sf1
    automatically matched to d1dqdl2
    complexed with sek; mutant

Details for d2h2sd2

PDB Entry: 2h2s (more details), 3.1 Å

PDB Description: crystal structure of e148a mutant of clc-ec1 in secn-
PDB Compounds: (D:) Fab fragment, light chain

SCOP Domain Sequences for d2h2sd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2sd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2h2sd2:

Click to download the PDB-style file with coordinates for d2h2sd2.
(The format of our PDB-style files is described here.)

Timeline for d2h2sd2: