Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
Domain d2h2pf1: 2h2p F:1-106 [136020] Other proteins in same PDB: d2h2pa_, d2h2pb_, d2h2pd2, d2h2pf2 automated match to d1ikfl1 complexed with sek |
PDB Entry: 2h2p (more details), 3.1 Å
SCOPe Domain Sequences for d2h2pf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2pf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil
Timeline for d2h2pf1:
View in 3D Domains from other chains: (mouse over for more information) d2h2pa_, d2h2pb_, d2h2pd1, d2h2pd2 |