Lineage for d2h2pb_ (2h2p B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957090Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1957091Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1957092Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1957093Protein Clc chloride channel [69913] (2 species)
  7. 1957094Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1957112Domain d2h2pb_: 2h2p B: [136017]
    Other proteins in same PDB: d2h2pd1, d2h2pd2, d2h2pf1, d2h2pf2
    automated match to d1kpla_
    complexed with sek

Details for d2h2pb_

PDB Entry: 2h2p (more details), 3.1 Å

PDB Description: crystal structure of clc-ec1 in complex with fab fragment in secn-
PDB Compounds: (B:) CLC Cl transporter

SCOPe Domain Sequences for d2h2pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2pb_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d2h2pb_:

Click to download the PDB-style file with coordinates for d2h2pb_.
(The format of our PDB-style files is described here.)

Timeline for d2h2pb_: