SCOPe 2.02: Domain d2h2pa1: 2h2p A:17-460

Lineage for d2h2pa1 (2h2p A:17-460)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (1 protein)
   duplication: consist of two similar structural parts

6. Protein Clc chloride channel [69913] (2 species)

7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)

8. Domain d2h2pa1: 2h2p A:17-460 [136016]
   Other proteins in same PDB: d2h2pd1, d2h2pd2, d2h2pf1, d2h2pf2
   automatically matched to d1kpka_
   complexed with sek

Details for d2h2pa1

PDB Entry: 2h2p, 3.1 Å

PDB Description: crystal structure of clc-ec1 in complex with fab fragment in secn-

PDB Compounds: (A:) CLC Cl transporter

SCOPe Domain Sequences for d2h2pa1:

Sequence; same for both SEQRES and ATOM records:

>d2h2pa1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

Timeline for d2h2pa1:

• d2h2pa1 first appeared in SCOP 1.73
  
• d2h2pa1 appears in SCOPe 2.01
  
• d2h2pa1 appears in SCOPe 2.03
  
• d2h2pa1 appears in the current release, SCOPe 2.08, called d2h2pa_