Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (10 PDB entries) |
Domain d2h26a2: 2h26 A:4-183 [135991] Other proteins in same PDB: d2h26a1, d2h26b_ automated match to d3t8xc1 complexed with 6pl, 6ul, gol, so4 |
PDB Entry: 2h26 (more details), 1.8 Å
SCOPe Domain Sequences for d2h26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h26a2 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr
Timeline for d2h26a2: