Lineage for d2h26a1 (2h26 A:184-279)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932610Protein CD1, alpha-3 domain [88615] (4 species)
  7. 932611Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)
  8. 932612Domain d2h26a1: 2h26 A:184-279 [135990]
    Other proteins in same PDB: d2h26a2, d2h26b_
    automatically matched to d1onqa1
    complexed with 6pl, 6ul, gol, so4

Details for d2h26a1

PDB Entry: 2h26 (more details), 1.8 Å

PDB Description: human cd1b in complex with endogenous phosphatidylcholine and spacer
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d2h26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywrn

SCOPe Domain Coordinates for d2h26a1:

Click to download the PDB-style file with coordinates for d2h26a1.
(The format of our PDB-style files is described here.)

Timeline for d2h26a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h26a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2h26b_