SCOP 1.75: Domain d2h26a1: 2h26 A:184-279

Lineage for d2h26a1 (2h26 A:184-279)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein CD1, alpha-3 domain [88615] (4 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)

8. Domain d2h26a1: 2h26 A:184-279 [135990]
   Other proteins in same PDB: d2h26a2, d2h26b1
   automatically matched to d1onqa1
   complexed with 6pl, 6ul, fuc, gol, nag, so4; mutant

Details for d2h26a1

PDB Entry: 2h26, 1.8 Å

PDB Description: human cd1b in complex with endogenous phosphatidylcholine and spacer

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOP Domain Sequences for d2h26a1:

Sequence; same for both SEQRES and ATOM records:

>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywrn

Timeline for d2h26a1:

• d2h26a1 first appeared in SCOP 1.73
  
• d2h26a1 appears in SCOPe 2.01
  
• d2h26a1 appears in the current release, SCOPe 2.08