Lineage for d2h1lr1 (2h1l R:96-289)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790093Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 790094Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)
  6. 790095Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 790096Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries)
  8. 790133Domain d2h1lr1: 2h1l R:96-289 [135964]
    Other proteins in same PDB: d2h1la1, d2h1lb1, d2h1lc1, d2h1ld1, d2h1le1, d2h1lf1, d2h1lg1, d2h1lh1, d2h1li1, d2h1lj1, d2h1lk1, d2h1ll1
    automatically matched to d1uola_
    complexed with zn

Details for d2h1lr1

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (R:) Cellular tumor antigen p53

SCOP Domain Sequences for d2h1lr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1lr1 b.2.5.2 (R:96-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOP Domain Coordinates for d2h1lr1:

Click to download the PDB-style file with coordinates for d2h1lr1.
(The format of our PDB-style files is described here.)

Timeline for d2h1lr1: