SCOPe 2.01: Domain d2gzha_: 2gzh A:

Lineage for d2gzha_ (2gzh A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)

8. Domain d2gzha_: 2gzh A: [135905]
   Other proteins in same PDB: d2gzhb1
   automated match to d1oiva_
   complexed with gtp, mg, po4

Details for d2gzha_

PDB Entry: 2gzh, 2.47 Å

PDB Description: crystal structure of rab11 in complex with rab11-family interacting protein 2

PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2gzha_:

Sequence; same for both SEQRES and ATOM records:

>d2gzha_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d2gzha_:

• d2gzha_ first appeared in SCOP 1.73, called d2gzha1
  
• d2gzha_ was called d2gzha1 in SCOP 1.75
  
• d2gzha_ appears in SCOPe 2.02
  
• d2gzha_ appears in the current release, SCOPe 2.08