Lineage for d2gzdd_ (2gzd D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709345Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 1709346Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 1709347Protein Rab11 family-interacting protein 2 [144272] (1 species)
  7. 1709348Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries)
    Uniprot Q7L804 468-502
  8. 1709351Domain d2gzdd_: 2gzd D: [135904]
    Other proteins in same PDB: d2gzda_, d2gzdb_
    automated match to d2gzdc1
    complexed with gtp, mg

Details for d2gzdd_

PDB Entry: 2gzd (more details), 2.44 Å

PDB Description: Crystal Structure of Rab11 in Complex with Rab11-FIP2
PDB Compounds: (D:) Rab11 family-interacting protein 2

SCOPe Domain Sequences for d2gzdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzdd_ h.1.31.1 (D:) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]}
rrkdthireledyidnllvrvmeetpsilrvpyep

SCOPe Domain Coordinates for d2gzdd_:

Click to download the PDB-style file with coordinates for d2gzdd_.
(The format of our PDB-style files is described here.)

Timeline for d2gzdd_: