Lineage for d2gywa1 (2gyw A:1-542)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 706660Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 706661Protein Acetylcholinesterase [53476] (5 species)
  7. 706676Species Mouse (Mus musculus) [TaxId:10090] [53479] (19 PDB entries)
  8. 706713Domain d2gywa1: 2gyw A:1-542 [135877]
    automatically matched to d1j06a_
    complexed with co3, fuc, nag, obi, p6g

Details for d2gywa1

PDB Entry: 2gyw (more details), 2.4 Å

PDB Description: crystal structure of mus musculus acetylcholinesterase in complex with obidoxime
PDB Compounds: (A:) acetylcholinesterase

SCOP Domain Sequences for d2gywa1:

Sequence, based on SEQRES records: (download)

>d2gywa1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
sa

Sequence, based on observed residues (ATOM records): (download)

>d2gywa1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdf
lsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigv
pqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvya
yifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartg
dpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa

SCOP Domain Coordinates for d2gywa1:

Click to download the PDB-style file with coordinates for d2gywa1.
(The format of our PDB-style files is described here.)

Timeline for d2gywa1: