SCOP 1.73: Domain d2gyqb1: 2gyq B:3-159

Lineage for d2gyqb1 (2gyq B:3-159)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.4: YciF-like [140445] (2 proteins)
   Pfam PF05974; DUF892

6. Protein Hypothetical ptotein RPA3308 [140446] (1 species)
   putative structural protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [140447] (1 PDB entry)

8. Domain d2gyqb1: 2gyq B:3-159 [135864]
   automatically matched to 2GYQ A:1-160
   complexed with act, edo, fe, na, zn

Details for d2gyqb1

PDB Entry: 2gyq, 1.4 Å

PDB Description: YcfI, a putative structural protein from Rhodopseudomonas palustris.

PDB Compounds: (B:) ycfI, putative structural protein

SCOP Domain Sequences for d2gyqb1:

Sequence; same for both SEQRES and ATOM records:

>d2gyqb1 a.25.1.4 (B:3-159) Hypothetical ptotein RPA3308 {Rhodopseudomonas palustris [TaxId: 1076]}
ffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqier
ldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiaryg
tliawaeelghddivrflttnlneekaantklntval

Timeline for d2gyqb1:

• d2gyqb1 is new in SCOP 1.73
  
• d2gyqb1 appears in SCOP 1.75
  
• d2gyqb1 appears in the current release, SCOPe 2.08, called d2gyqb_