Lineage for d2gya31 (2gya 3:2-48)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646594Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 646595Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 646596Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 646597Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 646598Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 646599Domain d2gya31: 2gya 3:2-48 [135834]
    Other proteins in same PDB: d2gya11, d2gya32, d2gya52, d2gyaj1, d2gyak1, d2gyan1, d2gyas1, d2gyat1, d2gyaw1
    automatically matched to d1rqua1

Details for d2gya31

PDB Entry: 2gya (more details), 2 Å

PDB Description: Structure of the 50S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (3:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d2gya31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gya31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
itkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaa

SCOP Domain Coordinates for d2gya31:

Click to download the PDB-style file with coordinates for d2gya31.
(The format of our PDB-style files is described here.)

Timeline for d2gya31: