Lineage for d2gwsm3 (2gws M:386-575)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740084Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 740211Protein DNA polymerase lambda [102943] (1 species)
  7. 740212Species Human (Homo sapiens) [TaxId:9606] [102944] (14 PDB entries)
  8. 740234Domain d2gwsm3: 2gws M:386-575 [135824]
    Other proteins in same PDB: d2gwsa1, d2gwsa2, d2gwse1, d2gwse2, d2gwsi1, d2gwsi2, d2gwsm1, d2gwsm2
    automatically matched to d1rzta3
    complexed with cac, cl, edo, mg, na

Details for d2gwsm3

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (M:) DNA polymerase lambda

SCOP Domain Sequences for d2gwsm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwsm3 d.218.1.2 (M:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOP Domain Coordinates for d2gwsm3:

Click to download the PDB-style file with coordinates for d2gwsm3.
(The format of our PDB-style files is described here.)

Timeline for d2gwsm3: